General Information

    • DRAMP ID

    • DRAMP02666

    • Peptide Name

    • WAP four-disulfide core domain protein 12 (primates, mammals, animals)

    • Source

    • Pan troglodytes (chimpanzee)

    • Family

    • Not found

    • Gene

    • WFDC12

    • Sequence

    • VKEDIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK

    • Sequence Length

    • 88

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02666 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02666.

Physicochemical Information

    • Formula

    • C414H649N119O135S10

    • Absent Amino Acids

    • M

    • Common Amino Acids

    • CEKP

    • Mass

    • 9774.02

    • PI

    • 5.34

    • Basic Residues

    • 15

    • Acidic Residues

    • 16

    • Hydrophobic Residues

    • 17

    • Net Charge

    • -1

    • Boman Index

    • -211.66

    • Hydrophobicity

    • -0.881

    • Aliphatic Index

    • 45.34

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 9105

    • Absorbance 280nm

    • 104.66

    • Polar Residues

    • 28

DRAMP02666

DRAMP02666 chydropathy plot

Comments Information

    • PTM

    • Contains four disulfide bonds 11-39; 18-43; 26-38; 32-47.

Literature Information

  • ·Literature 1

    • Title

    • Comparative sequence analyses reveal rapid and divergent evolutionary changes of the WFDC locus in the primate lineage.

    • Reference

    • Genome Res. 2007 Mar;17(3):276-286.

    • Author

    • Hurle B, Swanson W; NISC Comparative Sequencing Program, Green ED.