General Information

    • DRAMP ID

    • DRAMP02669

    • Peptide Name

    • Neutrophil defensin 1 (Defensin, alpha 1; primates, mammals, animals)

    • Source

    • Pan troglodytes (chimpanzee)

    • Family

    • Belongs to the alpha-defensin family

    • Gene

    • DEFA1

    • Sequence

    • ACYCRIPACLAGERRYGTCIYQGRLWAFCC

    • Sequence Length

    • 30

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02669 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02669.

Physicochemical Information

    • Formula

    • C150H228N44O38S6

    • Absent Amino Acids

    • DHKMNSV

    • Common Amino Acids

    • C

    • Mass

    • 3448.09

    • PI

    • 8.68

    • Basic Residues

    • 4

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +3

    • Boman Index

    • -32.29

    • Hydrophobicity

    • 0.277

    • Aliphatic Index

    • 65.33

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 356.72

    • Polar Residues

    • 13

DRAMP02669

DRAMP02669 chydropathy plot

Comments Information

    • MOA

    • Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Literature Information

  • ·Literature 1

    • Title

    • Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.

    • Reference

    • Physiol Genomics. 2004 Dec 15;20(1):1-11. Epub 2004 Oct 19.

    • Author

    • Patil A, Hughes AL, Zhang G.