General Information

    • DRAMP ID

    • DRAMP02672

    • Peptide Name

    • Beta-defensin 4A (Beta-defensin 2, BD-2; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB4A

    • Sequence

    • GISDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

    • Sequence Length

    • 41

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02672 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02672.

Physicochemical Information

    • Formula

    • C189H313N55O51S6

    • Absent Amino Acids

    • EMNW

    • Common Amino Acids

    • C

    • Mass

    • 4364.26

    • PI

    • 9.3

    • Basic Residues

    • 8

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +7

    • Boman Index

    • -41.31

    • Hydrophobicity

    • -0.112

    • Aliphatic Index

    • 64.15

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 46.63

    • Polar Residues

    • 17

DRAMP02672

DRAMP02672 chydropathy plot

Comments Information

    • Function

    • Problely has antimicrobial activity.

    • PTM

    • Problely contains three disulfide bonds 8-37; 15-30; 20-38.

Literature Information

  • ·Literature 1

    • Title

    • Expression of beta-defensin-2 in chimpanzee (Pan troglodytes).

    • Reference

    • Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases

    • Author

    • Duits LA, Langermans JAM, van der Straaten T, Vervenne RAW, Paltansing S, Frost PA, Hiemstra PS, Thomas AW, Nibbering PH.