General Information

    • DRAMP ID

    • DRAMP02675

    • Peptide Name

    • Beta-defensin 105A (Beta-defensin 5, BD-5; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB105A

    • Sequence

    • GLDFSQPFPSGEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRQRI

    • Sequence Length

    • 51

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02675 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02675.

Physicochemical Information

    • Formula

    • C244H391N75O74S7

    • Absent Amino Acids

    • HMTWY

    • Common Amino Acids

    • C

    • Mass

    • 5783.67

    • PI

    • 8.26

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +2

    • Boman Index

    • -128.54

    • Hydrophobicity

    • -0.61

    • Aliphatic Index

    • 53.53

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 7.5

    • Polar Residues

    • 18

DRAMP02675

DRAMP02675 chydropathy plot

Comments Information

    • Function

    • Problely has antimicrobial activity.

    • PTM

    • Problely contains three disulfide bonds 16-47; 26-40; 30-46.

Literature Information

  • ·Literature 1

    • Title

    • The complexity of selection at the major primate beta-defensin locus.

    • Reference

    • BMC Evol Biol. 2005 May 18;5:32.

    • Author

    • Semple CA, Maxwell A, Gautier P, Kilanowski FM, Eastwood H, Barran PE, Dorin JR.
  • ·Literature 2

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.