General Information

    • DRAMP ID

    • DRAMP02677

    • Peptide Name

    • Beta-defensin 107A (Beta-defensin 7; BD-7, DEFB-7, cBD-7; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB107A

    • Sequence

    • AIHRALISKRMEGHCEAECLTFEVKTGGCRAELAPFCCKNRKKH

    • Sequence Length

    • 44

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02677 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02677.

Physicochemical Information

    • Formula

    • C211H348N68O59S6

    • Absent Amino Acids

    • DQWY

    • Common Amino Acids

    • ACEK

    • Mass

    • 4973.86

    • PI

    • 9.02

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +7

    • Boman Index

    • -95.42

    • Hydrophobicity

    • -0.443

    • Aliphatic Index

    • 62.27

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 250

    • Absorbance 280nm

    • 5.81

    • Polar Residues

    • 12

DRAMP02677

DRAMP02677 chydropathy plot

Comments Information

    • PTM

    • Contains two disulfide bonds 15-29; 19-38.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract. The complexity of selection at the major primate beta-defensin locus.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G. Semple C.A.M, Maxwell A, Gautier P, Kilanowski F.M, Eastwood H, Barran P.E, Dorin J.R.
  • ·Literature 2

    • Title

    • Reference

    • BMC Evol Biol. 2005 May 18;5:32.

    • Author