General Information

    • DRAMP ID

    • DRAMP02678

    • Peptide Name

    • Beta-defensin 108B (Beta-defensin 8; BD-8, DEFB-8, hBD-8; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB108B

    • Sequence

    • KFKEICERPDGSCRDFCLETEIHVGRCLNSRPCCLPLGHQPRIESTTPKKD

    • Sequence Length

    • 51

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02678 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02678.

Physicochemical Information

    • Formula

    • C247H402N76O76S6

    • Absent Amino Acids

    • AMWY

    • Common Amino Acids

    • CEPR

    • Mass

    • 5844.73

    • PI

    • 7.79

    • Basic Residues

    • 11

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +3

    • Boman Index

    • -141.48

    • Hydrophobicity

    • -0.778

    • Aliphatic Index

    • 59.22

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 7.5

    • Polar Residues

    • 16

DRAMP02678

DRAMP02678 chydropathy plot

Comments Information

    • PTM

    • contains three disulfide bonds 6-33; 13-27; 17-34.

Literature Information

  • ·Literature 1

    • Title

    • The complexity of selection at the major primate beta-defensin locus.

    • Reference

    • BMC Evol Biol. 2005 May 18;5:32.

    • Author

    • Semple C.A.M, Maxwell A, Gautier P, Kilanowski F.M, Eastwood H, Barran P.E, Dorin J.R.