• DRAMP ID

    • DRAMP02679
    • Peptide Name

    • Beta-defensin109 (Defensin, beta 109; Defensin, beta 109; primates, mammals, animals)
    • Source

    • Pan troglodytes (Chimpanzee)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB109
    • Sequence

    • GLGPAEGHCLNLSGVCRRDVCKVVEDQIGACRRRMKCCRAWWILMPIPTPLIMSDYQEPLKRKLK
    • Sequence Length

    • 65
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02679 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02679.
    • Formula

    • C323H536N98O85S9
    • Absent Amino Acids

    • F
    • Common Amino Acids

    • LRC
    • Mass

    • 7440.95
    • PI

    • 9.3
    • Basic Residues

    • 13
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 20
    • Net Charge

    • +7
    • Boman Index

    • -110.87
    • Hydrophobicity

    • -0.209
    • Aliphatic Index

    • 88.46
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12865
    • Absorbance 280nm

    • 201.02
    • Polar Residues

    • 16

DRAMP02679

DRAMP02679 chydropathy plot
    • Function

    • Has antibacterial activity (By similarity).
    • PYM

    • Problely contrains three disulfide bonds.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.