General Information

    • DRAMP ID

    • DRAMP02680

    • Peptide Name

    • Beta-defensin 110 (Defensin, beta 110; Beta-defensin 111; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB110

    • Sequence

    • KMKYPEYGSLDLRRECRMGNGRCKNQCHENEIRIAYCIRPGTHCCLQQ

    • Sequence Length

    • 48

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02680 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02680.

Physicochemical Information

    • Formula

    • C236H383N79O70S8

    • Absent Amino Acids

    • FVW

    • Common Amino Acids

    • CR

    • Mass

    • 5703.6

    • PI

    • 8.89

    • Basic Residues

    • 11

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +6

    • Boman Index

    • -146.91

    • Hydrophobicity

    • -1.006

    • Aliphatic Index

    • 50.83

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 103.09

    • Polar Residues

    • 18

DRAMP02680

DRAMP02680 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 16-44; 23-37; 27-45.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.