General Information

    • DRAMP ID

    • DRAMP02684

    • Peptide Name

    • Beta-defensin 124 (Defensin, beta 124; Defensin, beta 126; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB124

    • Sequence

    • EFKRCWKGQGACRTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE

    • Sequence Length

    • 49

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02684 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02684.

Physicochemical Information

    • Formula

    • C252H383N69O71S7

    • Absent Amino Acids

    • IN

    • Common Amino Acids

    • C

    • Mass

    • 5739.65

    • PI

    • 8.32

    • Basic Residues

    • 9

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -92.02

    • Hydrophobicity

    • -0.696

    • Aliphatic Index

    • 43.88

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11835

    • Absorbance 280nm

    • 246.56

    • Polar Residues

    • 17

DRAMP02684

DRAMP02684 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity.

    • PTM

    • Problely contains three disulfide bonds 5-32; 12-26; 16-33.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.