• DRAMP ID

    • DRAMP02684
    • Peptide Name

    • Beta-defensin 124 (Defensin, beta 124; Defensin, beta 126; primates, mammals, animals)
    • Source

    • Pan troglodytes (Chimpanzee)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB124
    • Sequence

    • EFKRCWKGQGACRTYCTRQETYMHLCPDASLCCLSYALKPPPVPKHEYE
    • Sequence Length

    • 49
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02684 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02684.
    • Formula

    • C252H383N69O71S7
    • Absent Amino Acids

    • IN
    • Common Amino Acids

    • C
    • Mass

    • 5739.65
    • PI

    • 8.32
    • Basic Residues

    • 9
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +4
    • Boman Index

    • -92.02
    • Hydrophobicity

    • -0.696
    • Aliphatic Index

    • 43.88
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11835
    • Absorbance 280nm

    • 246.56
    • Polar Residues

    • 17

DRAMP02684

DRAMP02684 chydropathy plot
    • Function

    • Has antibacterial activity.
    • PTM

    • Problely contains three disulfide bonds 5-32; 12-26; 16-33.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.