General Information

    • DRAMP ID

    • DRAMP02689

    • Peptide Name

    • Beta-defensin 118 (Defensin, beta 118; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB118

    • Sequence

    • AYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCVPSNEDH

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02689 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02689.

Physicochemical Information

    • Formula

    • C197H317N67O65S6

    • Absent Amino Acids

    • FIM

    • Common Amino Acids

    • CK

    • Mass

    • 4856.45

    • PI

    • 8.63

    • Basic Residues

    • 11

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +5

    • Boman Index

    • -141.08

    • Hydrophobicity

    • -1.251

    • Aliphatic Index

    • 29.53

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 175.36

    • Polar Residues

    • 17

DRAMP02689

DRAMP02689 chydropathy plot

Comments Information

    • Function

    • Potentially has antibacterial activity.

    • PTM

    • Contains three disulfide bonds 8-35; 15-29; 19-36.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2

    • Title

    • Evolution and sequence variation of human beta-defensin genes.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hollox EJ, Armour JAL.