General Information

    • DRAMP ID

    • DRAMP02695

    • Peptide Name

    • Beta-defensin 131 (Defensin, beta 131; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB131

    • Sequence

    • FISNDECPSEYYYHCRLKCNADEHAIRYCADFSICCKLKIIEIHGQKKW

    • Sequence Length

    • 49

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02695 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02695.

Physicochemical Information

    • Formula

    • C261H392N70O74S6

    • Absent Amino Acids

    • MTV

    • Common Amino Acids

    • CI

    • Mass

    • 5886.77

    • PI

    • 6.97

    • Basic Residues

    • 10

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +3

    • Boman Index

    • -92.85

    • Hydrophobicity

    • -0.469

    • Aliphatic Index

    • 69.8

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 11835

    • Absorbance 280nm

    • 246.56

    • Polar Residues

    • 16

DRAMP02695

DRAMP02695 chydropathy plot

Comments Information

    • Function

    • Potentially has antibacterial activity.

    • PTM

    • Contains three disulfide bonds 7-35; 15-29; 19-36.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.

    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.

    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2

    • Title

    • Evolution and sequence variation of human beta-defensin genes.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hollox EJ, Armour JAL.