• DRAMP ID

    • DRAMP02696
    • Peptide Name

    • Beta-defensin 132 (Defensin, beta 132; primates, mammals, animals)
    • Source

    • Pan troglodytes (Chimpanzee)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB132
    • Sequence

    • GGSKCVSNTPGYCRTYCHWGETALFMCNASRKCCVSYSFLPKADLPRLIGNHWQSRRRNTQRKDKKQQTTVTS
    • Sequence Length

    • 73
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02696 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02696.
    • Formula

    • C357H566N114O105S7
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • RSTCK
    • Mass

    • 8359.54
    • PI

    • 9.85
    • Basic Residues

    • 15
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 15
    • Net Charge

    • +12
    • Boman Index

    • -194.74
    • Hydrophobicity

    • -0.858
    • Aliphatic Index

    • 42.74
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 15845
    • Absorbance 280nm

    • 220.07
    • Polar Residues

    • 32

DRAMP02696

DRAMP02696 chydropathy plot
    • Function

    • Potentially has antibacterial activity.
    • PTM

    • Contains three disulfide bonds 5-33; 13-27; 17-34.
  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil A.A, Cai Y, Sang Y, Blecha F, Zhang G.
  • ·Literature 2
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hollox EJ, Armour JAL.