• DRAMP ID

    • DRAMP02716
    • Peptide Name

    • Beta-defensin 105A (Defensin, beta 105; Defensin, beta 105A; primates, mammals,animals)
    • Source

    • Pongo pygmaeus (Bornean orangutan)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB105A
    • Sequence

    • GLDFSQPFPSDEFAVCESCKLGRGKCRKECLENEKPDGNCRLNFLCCRERI
    • Sequence Length

    • 51
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02716 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02716.
    • Formula

    • C246H392N74O77S7
    • Absent Amino Acids

    • HMTWY
    • Common Amino Acids

    • CE
    • Mass

    • 5842.69
    • PI

    • 6.37
    • Basic Residues

    • 9
    • Acidic Residues

    • 9
    • Hydrophobic Residues

    • 12
    • Net Charge

    • 0
    • Boman Index

    • -139.47
    • Hydrophobicity

    • -0.671
    • Aliphatic Index

    • 53.53
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 7.5
    • Polar Residues

    • 17

DRAMP02716

DRAMP02716 chydropathy plot
    • Function

    • Has antimicrobial activity (By similarity).
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ database
    • Author

    • Hollox E.J, Armour J.A.L.