• DRAMP ID

    • DRAMP02718
    • Peptide Name

    • Beta-defensin 123 (Defensin, beta 123; primates, mammals, animals)
    • Source

    • Pongo pygmaeus (Bornean orangutan)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB123
    • Sequence

    • GTQRCWNLYGKCRHRCSKKERVYVYCVNNKMCCVKPKYQPKERWWRF
    • Sequence Length

    • 47
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02718 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02718.
    • Formula

    • C264H406N82O63S7
    • Absent Amino Acids

    • ADI
    • Common Amino Acids

    • K
    • Mass

    • 5961.06
    • PI

    • 9.87
    • Basic Residues

    • 14
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +12
    • Boman Index

    • -141.22
    • Hydrophobicity

    • -1.172
    • Aliphatic Index

    • 32.98
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 22835
    • Absorbance 280nm

    • 496.41
    • Polar Residues

    • 17

DRAMP02718

DRAMP02718 chydropathy plot
    • Function

    • Potentially has antibacterial activity.
    • PTM

    • Problely contains three disulfide bonds 5-32; 12-26; 16-33.
  • ·Literature 1
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hollox E.J, Armour J.A.L.