General Information

    • DRAMP ID

    • DRAMP02720

    • Peptide Name

    • Beta-defensin 128 (Defensin, beta 128; primates, mammals, animals)

    • Source

    • Pongo pygmaeus (Bornean orangutan)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB128

    • Sequence

    • ARLKKCFNNVTGYCRKKCKVGERYEIGCLSGKLCCINYEEEKEHVSFKKPHQHSGEKLSVQQDYIILPTVTIFTV

    • Sequence Length

    • 75

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02720 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02720.

Physicochemical Information

    • Formula

    • C384H614N106O110S6

    • Absent Amino Acids

    • MW

    • Common Amino Acids

    • K

    • Mass

    • 8668.1

    • PI

    • 8.96

    • Basic Residues

    • 16

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +8

    • Boman Index

    • -135.04

    • Hydrophobicity

    • -0.475

    • Aliphatic Index

    • 76.53

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 85.61

    • Polar Residues

    • 26

DRAMP02720

DRAMP02720 chydropathy plot

Comments Information

    • Function

    • Potentially has antibacterial activity.

    • PTM

    • Problely contains three disulfide bonds 6-34; 14-28; 18-35.

Literature Information

  • ·Literature 1

    • Title

    • Evolution and sequence variation of human beta-defensin genes.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hollox E.J, Armour J.A.L.