General Information

    • DRAMP ID

    • DRAMP02725

    • Peptide Name

    • Antibacterial protein LL-37 (cathelicidin; primates, mammals, animals)

    • Source

    • Nomascus leucogenys (White-cheeked Gibbon)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • LLGNFFRKAREKIGKEFKRIVQRIKDFLQHLVPRTEA

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipopolysaccharide (LPS)-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02725 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02725.

Physicochemical Information

    • Formula

    • C206H338N62O50

    • Absent Amino Acids

    • CMSWY

    • Common Amino Acids

    • KR

    • Mass

    • 4483.34

    • PI

    • 11

    • Basic Residues

    • 11

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +7

    • Boman Index

    • -96.51

    • Hydrophobicity

    • -0.565

    • Aliphatic Index

    • 94.86

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 4

DRAMP02725

DRAMP02725 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity. (By similarity)

Literature Information

  • ·Literature 1

    • Title

    • Evolution of the primate cathelicidin. Correlation between structural variations and antimicrobial activity.

    • Reference

    • J Biol Chem. 2006 Jul 21;281(29):19861-19871.

    • Author

    • Zelezetsky I, Pontillo A, Puzzi L, Antcheva N, Segat L, Pacor S, Crovella S, Tossi A.