• • DRAMP ID

  • DRAMP02727

• • Peptide Name

  • HmdSL-37 (cathelicidin; primates, mammals, animals)

• • Source

  • Hylobates sp. (Gibbon)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • SLGNFFRKARKKIGEEFKRIVQRIKDFLQHLIPRTEA

• • Sequence Length

  • 37

• • UniProt Entry

  • No entry found

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Antifungal

• • Target Organism

  • In 20% TSB in SPB medium Escherichia coli (MIC=2 µM), Pseudomonas aeruginosa (MIC=8 µM), Staphylococcus aureus (MIC>32 µM), Enterococcus faecalis (MIC=8 µM).##In 20% SAB in SPB Candida albicans (MIC>32 µM). In 5% SAB in SPB Candida albicans (MIC=8 µM). In 20% SAB in PIL Candida albicans (MIC>32 µM).##In 5% TSB in SPB Escherichia coli (MIC=1 µM), Pseudomonas aeruginosa (MIC=2 µM), Staphylococcus aureus (MIC=2 µM).##In 20% TSB in PIL Escherichia coli (MIC>32 µM), Pseudomonas aeruginosa (MIC=16-32 µM); Staphylococcus aureus (MIC=8-16 µM), Enterococcus faecalis (MIC>32 µM).##In 50% MH in SPB medium Escherichia coli (MIC>32 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02727.

DRAMP02727

• • Function

  • Has antibacterial activity.

• ·Literature 1

• • Title

  • Evolution of the primate cathelicidin. Correlation between structural variations and antimicrobial activity.

• • Pubmed ID

  • 16720578

• • Reference

  • J Biol Chem. 2006 Jul 21;281(29):19861-19871.

• • Author

  • Zelezetsky I, Pontillo A, Puzzi L, Antcheva N, Segat L, Pacor S, Crovella S, Tossi A.