• DRAMP ID

    • DRAMP02729
    • Peptide Name

    • Beta-defensin 107A (Defensin, beta 107; Defensin, beta 107A; primates, mammals, animals)
    • Source

    • Hylobates lar (Common gibbon) (White-handed gibbon); also Pongo pygmaeus (Bornean orangutan)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB107A
    • Sequence

    • AIHRALICKRMEGHCEAECLTFEVKIGGCRAELAPFCCKNRKKH
    • Sequence Length

    • 44
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02729 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02729.
    • Formula

    • C213H352N68O57S7
    • Absent Amino Acids

    • DQSWY
    • Common Amino Acids

    • C
    • Mass

    • 5001.98
    • PI

    • 8.91
    • Basic Residues

    • 12
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +7
    • Boman Index

    • -83.25
    • Hydrophobicity

    • -0.25
    • Aliphatic Index

    • 71.14
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 8.72
    • Polar Residues

    • 11

DRAMP02729

DRAMP02729 chydropathy plot
    • Function

    • Potentially has antibacterial activity.
    • PTM

    • Problely contains two disulfide bonds 15-29; 19-38.
  • ·Literature 1
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hollox EJ, Armour JAL.