• • DRAMP ID

  • DRAMP02730

• • Peptide Name

  • Beta-defensin 104A (Defensin, beta 104; Defensin, beta 104A; primates, mammals, animals)

• • Source

  • Hylobates lar (Common gibbon) (White-handed gibbon)

• • Family

  • Belongs to the beta-defensin family

• • Gene

  • DEFB104A

• • Sequence

  • EFEWDRICGYGTARCRNKCRSQEYRIGRCPNTFACCLRKWDESLLNSTKP

• • Sequence Length

  • 50

• • UniProt Entry

  • A4H204

• • Protein Existence

  • Homology

• • Biological Activity

  • Antimicrobial

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP02730.

DRAMP02730

• • Function

  • Has antimicrobial activity (By similarity).

• • PTM

  • Contains three disulfide bonds (By similarity).

• ·Literature 1

• • Title

  • Evolution and sequence variation of human beta-defensin genes.

• • Pubmed ID

  • PubMed ID is not available

• • Reference

  • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

• • Author

  • Hollox EJ, Armour JAL.