• DRAMP ID

    • DRAMP02736
    • Peptide Name

    • Beta-defensin 128 (Defensin, beta 128; primates, mammals, animals)
    • Source

    • Hylobates lar (Common gibbon) (White-handed gibbon)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB128
    • Sequence

    • ARLKKCFNNITGYCRKKCKVGERYEIGCLSGKLCCVNDEEEKKHVSFKKPHQHSGEKLSVQQDYIILPTITIFAV
    • Sequence Length

    • 75
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02736 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02736.
    • Formula

    • C380H615N107O108S6
    • Absent Amino Acids

    • MW
    • Common Amino Acids

    • K
    • Mass

    • 8603.08
    • PI

    • 9.12
    • Basic Residues

    • 17
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 21
    • Net Charge

    • +9
    • Boman Index

    • -137.1
    • Hydrophobicity

    • -0.472
    • Aliphatic Index

    • 79.2
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 65.47
    • Polar Residues

    • 24

DRAMP02736

DRAMP02736 chydropathy plot
    • Function

    • Potentially has antibacterial activity.
    • PTM

    • Problely contains three disulfide bonds 6-34; 14-28; 18-35.
  • ·Literature 1
    • Title

    • Evolution and sequence variation of human beta-defensin genes.
    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases
    • Author

    • Hollox EJ, Armour JAL.