General Information

    • DRAMP ID

    • DRAMP02737

    • Peptide Name

    • Beta-defensin 132 (Defensin, beta 132; primates, mammals, animals)

    • Source

    • Hylobates lar (Common gibbon) (White-handed gibbon)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB132

    • Sequence

    • GGSKCVSDTQGYCRTYCHQGETALFMCNASRKCCASYSFLPKPDLPQLIGNHWQSRRRNTQRKDKKQQTTVTSS

    • Sequence Length

    • 74

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02737 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02737.

Physicochemical Information

    • Formula

    • C353H563N113O111S7

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • SQT

    • Mass

    • 8390.46

    • PI

    • 9.54

    • Basic Residues

    • 14

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +10

    • Boman Index

    • -208.29

    • Hydrophobicity

    • -0.982

    • Aliphatic Index

    • 38.24

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 141.71

    • Polar Residues

    • 32

DRAMP02737

DRAMP02737 chydropathy plot

Comments Information

    • Function

    • Potentially has antibacterial activity.

    • PTM

    • Problely contains three disulfide bonds 5-33; 13-27; 17-34.

Literature Information

  • ·Literature 1

    • Title

    • Evolution and sequence variation of human beta-defensin genes.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases

    • Author

    • Hollox EJ, Armour JAL.