General Information

    • DRAMP ID

    • DRAMP02742

    • Peptide Name

    • Defensin-like turtle egg white protein TEWP (TEWP; Reptiles, animals)

    • Source

    • Caretta caretta (Loggerhead sea turtle)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • QKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVK

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antiviral

    • Target Organism

      • Gram-negative bacteria: Escherichia coli (IC50=3.3 µM), Salmonella typhimurium (IC50=2.8 µM);
      • Gram-positive bacterium: Staphylococcus aureus (IC50=5. 1µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Beta strand (2 strands; 2 residues)

    • Structure Description

    • Three-dimensional structure of TEWP was determined by distance geometry and simulated annealing. The protein has no α-helix and consists of two antiparallel β-sheets. The secondary structure is consistent with the previously obtained circular dichroism spectra.

    • Helical Wheel Diagram

    • DRAMP02742 helical wheel diagram

    • PDB ID

    • 2B5B resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP02742.

Physicochemical Information

    • Formula

    • C177H297N53O45S6

    • Absent Amino Acids

    • ADFMSW

    • Common Amino Acids

    • K

    • Mass

    • 4079.99

    • PI

    • 9.54

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +9

    • Boman Index

    • -60.38

    • Hydrophobicity

    • -0.608

    • Aliphatic Index

    • 56.67

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 95.86

    • Polar Residues

    • 14

DRAMP02742

DRAMP02742 chydropathy plot

Comments Information

    • Function

    • The protein showes strong antibacterial activity against Escherichia coli and Salmonella typhimurium and also showes significant antiviral activity against an enveloped rhabdovirus, Chandipura virus, which is an emerging human pathogen.

    • Tissue specificity

    • Detected in egg white (at protein level).

Literature Information

  • ·Literature 1

    • Title

    • Small cationic protein from a marine turtle has beta-defensin-like fold and antibacterial and antiviral activity.

    • Reference

    • Proteins. 2006 Aug 1;64(2):524-531.

    • Author

    • Chattopadhyay S, Sinha NK, Banerjee S, Roy D, Chattopadhyay D, Roy S.