General Information

    • DRAMP ID

    • DRAMP02743

    • Peptide Name

    • Diapause-specific peptide (Dsp)

    • Source

    • Gastrophysa atrocyanea

    • Family

    • Belongs to the diapausin family

    • Gene

    • Not found

    • Sequence

    • AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN

    • Sequence Length

    • 41

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • Trichophyton rubrum.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02743 helical wheel diagram

    • PDB ID

    • 2E2F resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP02743.

Physicochemical Information

    • Formula

    • C184H288N62O55S7

    • Absent Amino Acids

    • FKLTW

    • Common Amino Acids

    • CG

    • Mass

    • 4473.11

    • PI

    • 8.35

    • Basic Residues

    • 7

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +4

    • Boman Index

    • -82.6

    • Hydrophobicity

    • -0.371

    • Aliphatic Index

    • 47.56

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 121.13

    • Polar Residues

    • 18

DRAMP02743

DRAMP02743 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity against Trichophyton rubrum. Blocks voltage-dependent N-type calcium channels (Cav2.2 / CACNA1B).

    • Tissue specificity

    • Highly expressed in the fat body.

    • Developmental stage

    • Produced throughout adult diapause, and to a minor extent in pupae, but not in eggs, larvae, or post-diapausing adults. Inhibition of DSP expression does not affect the onset or maintenance of diapause, indicating that the expression of DSP accompanies but does not play a direct role in the induction or maintenance of diapause.

Literature Information

  • ·Literature 1

    • Title

    • A specific peptide produced during adult diapause of the leaf beetle, Gastrophysa atrocyanea Moschulsky (Coleoptara: Chrysomelidae)

    • Reference

    • Appl. Entomol. Zool. 1998; 33: 535-543.

    • Author

    • Tanaka H et al. Suzuki K