• DRAMP ID

    • DRAMP02743
    • Peptide Name

    • Diapause-specific peptide (Dsp)
    • Source

    • Gastrophysa atrocyanea
    • Family

    • Belongs to the diapausin family
    • Gene

    • Not found
    • Sequence

    • AVRIGPCDQVCPRIVPERHECCRAHGRSGYAYCSGGGMYCN
    • Sequence Length

    • 41
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • Trichophyton rubrum.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02743 helical wheel diagram
    • PDB ID

    • 2E2F resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP02743.
    • Formula

    • C184H288N62O55S7
    • Absent Amino Acids

    • FKLTW
    • Common Amino Acids

    • CG
    • Mass

    • 4473.11
    • PI

    • 8.35
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +4
    • Boman Index

    • -82.6
    • Hydrophobicity

    • -0.371
    • Aliphatic Index

    • 47.56
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 121.13
    • Polar Residues

    • 18

DRAMP02743

DRAMP02743 chydropathy plot
    • Function

    • Has antifungal activity against Trichophyton rubrum. Blocks voltage-dependent N-type calcium channels (Cav2.2 / CACNA1B).
    • Tissue specificity

    • Highly expressed in the fat body.
    • Developmental stage

    • Produced throughout adult diapause, and to a minor extent in pupae, but not in eggs, larvae, or post-diapausing adults. Inhibition of DSP expression does not affect the onset or maintenance of diapause, indicating that the expression of DSP accompanies but does not play a direct role in the induction or maintenance of diapause.
  • ·Literature 1
    • Title

    • A specific peptide produced during adult diapause of the leaf beetle, Gastrophysa atrocyanea Moschulsky (Coleoptara: Chrysomelidae)
    • Reference

    • Appl. Entomol. Zool. 1998; 33: 535-543.
    • Author

    • Tanaka H et al. Suzuki K