• DRAMP ID

    • DRAMP02754
    • Peptide Name

    • Ponericin G2 (ants, insects, animals)
    • Source

    • Pachycondyla goeldii (Ponerine ant)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GWKDWLKKGKEWLKAKGPGIVKAALQAATQ
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • Saccharomyces cerevisae
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02754 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02754.
    • Formula

    • C155H248N42O38
    • Absent Amino Acids

    • CFHMNRSY
    • Common Amino Acids

    • K
    • Mass

    • 3307.93
    • PI

    • 10.13
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +5
    • Boman Index

    • -24.51
    • Hydrophobicity

    • -0.627
    • Aliphatic Index

    • 78.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 16500
    • Absorbance 280nm

    • 568.97
    • Polar Residues

    • 5

DRAMP02754

DRAMP02754 chydropathy plot
    • MOA

    • The comparison of ponericins with those well-studied peptides suggests that ponericins may adopt an amphipathic alpha-helical structure on cell membranes.
  • ·Literature 1
    • Title

    • Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.
    • Reference

    • J. Biol. Chem. 2001; 276: 17823-17829.
    • Author

    • Orivel J, Redeker V, Le Caer JP, Krier F, Revol-Junelles AM, Longeon A, Chafotte A, Dejean A, Rossier J.