General Information

    • DRAMP ID

    • DRAMP02754

    • Peptide Name

    • Ponericin G2 (ants, insects, animals)

    • Source

    • Pachycondyla goeldii (Ponerine ant)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • GWKDWLKKGKEWLKAKGPGIVKAALQAATQ

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • Saccharomyces cerevisae

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02754 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02754.

Physicochemical Information

    • Formula

    • C155H248N42O38

    • Absent Amino Acids

    • CFHMNRSY

    • Common Amino Acids

    • K

    • Mass

    • 3307.93

    • PI

    • 10.13

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +5

    • Boman Index

    • -24.51

    • Hydrophobicity

    • -0.627

    • Aliphatic Index

    • 78.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 16500

    • Absorbance 280nm

    • 568.97

    • Polar Residues

    • 5

DRAMP02754

DRAMP02754 chydropathy plot

Comments Information

    • MOA

    • The comparison of ponericins with those well-studied peptides suggests that ponericins may adopt an amphipathic alpha-helical structure on cell membranes.

Literature Information

  • ·Literature 1

    • Title

    • Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.

    • Reference

    • J. Biol. Chem. 2001; 276: 17823-17829.

    • Author

    • Orivel J, Redeker V, Le Caer JP, Krier F, Revol-Junelles AM, Longeon A, Chafotte A, Dejean A, Rossier J.