• DRAMP ID

    • DRAMP02755
    • Peptide Name

    • Ponericin G3 (ants, insects, animals)
    • Source

    • Pachycondyla goeldii (Ponerine ant)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GWKDWLNKGKEWLKKKGPGIMKAALKAATQ
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacteria: Bacillus cereus CIP 6624a, B. megaterium ATCC 9885b, B. stearothermophilus CIP 675, B. stearothermophilus CIP 675, B. subtilis ATCC 6623, Enterococcus faecalis CIP 636, Lactococcus lactis ssp. cremoris I116, Streptococcus pyogenes CIP 561, S. sanguinis CIP 55128, Listeria ivanovii LMA 94d, Listeria monocytogenes ATCC 15313, Micrococcus luteus CIP 5345, Staphylococcus aureus CIP 677, Staphylococcus aureus LMA, S. epidermidis CIP 53134;
      • Gram-negative bacteria: Escherichia coli, Enterobacter cloacae CIP 6085, Klebsiella pneumoniae CIP 8291, Proteus mirabilis LMA TP, Salmonella enterica CIP 813, Serratia marcescens LMA TP, Alcaligenes faecalis CIP 6723, Pseudomonas aeruginosa CIP A22, Proteus mirabilis LMA TP, Flavobacterium meningosepticum CIP 6057, Pseudomonas aeruginosa CIP A22, Yersinia entericolitica CIP 6529, P. putida LMA, Saccharomyces cerevisiae LMA 720.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02755 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02755.
    • Formula

    • C157H253N43O38S
    • Absent Amino Acids

    • CFHRSVY
    • Common Amino Acids

    • K
    • Mass

    • 3383.06
    • PI

    • 10.22
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 11
    • Net Charge

    • +6
    • Boman Index

    • -34.66
    • Hydrophobicity

    • -0.893
    • Aliphatic Index

    • 65.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 16500
    • Absorbance 280nm

    • 568.97
    • Polar Residues

    • 6

DRAMP02755

DRAMP02755 chydropathy plot
    • MOA

    • The comparison of ponericins with those well-studied peptides suggests that ponericins may adopt an amphipathic alpha-helical structure on cell membranes.
  • ·Literature 1
    • Title

    • Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.
    • Reference

    • J. Biol. Chem. 2001; 276: 17823-17829.
    • Author

    • Orivel J, Redeker V, Le Caer JP, Krier F, Revol-Junelles AM, Longeon A, Chafotte A, Dejean A, Rossier J.