• DRAMP ID

    • DRAMP02771
    • Peptide Name

    • Pilosulin 4 (ants, insects, animals)
    • Source

    • Myrmecia banksi (Jack jumper ant) (Australian jumper ant)
    • Family

    • Belongs to the pilosulin family
    • Gene

    • Not found
    • Sequence

    • FDITKLNIKKLTKATCKVISKGASMCKVLFDKKKQE
    • Sequence Length

    • 36
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.15246874]Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureusMIC<6.25 µM
        Bacillus subtilis (MIC<50 µM);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Pseudomonas aeruginosaMIC<25 µM
        Escherichia coliMIC<6.25 µM
    • Hemolytic Activity

      • [Ref.15246874]Non-hemolytic activity at 50 μM against human whole blood
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • IgE
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02771 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02771.
    • Formula

    • C183H318N48O50S3
    • Absent Amino Acids

    • HPRWY
    • Common Amino Acids

    • K
    • Mass

    • 4087.01
    • PI

    • 9.87
    • Basic Residues

    • 10
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +7
    • Boman Index

    • -53.41
    • Hydrophobicity

    • -0.311
    • Aliphatic Index

    • 86.67
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 3.57
    • Polar Residues

    • 9

DRAMP02771

DRAMP02771 chydropathy plot
    • Function

    • Shows activity against E.coli and S.aureus, moderate activity against P.aeruginosa, weak activity against B.subtilis, and has no effect against L.garvieae, C.albicans, and S.cerevisiae. Has no hemolytic nor cytolytic activity. Causes an IgE-independent histamine release.
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Molecular cloning and biological characterization of novel antimicrobial peptides, pilosulin 3 and pilosulin 5, from a species of the Australian ant genus Myrmecia.
    • Reference

    • Arch Biochem Biophys. 2004 Aug 15;428(2):170-178.
    • Author

    • Inagaki H, Akagi M, Imai HT, Taylor RW, Kubo T.