General Information

    • DRAMP ID

    • DRAMP02777

    • Peptide Name

    • Rhinocerosin (Insects, animals)

    • Source

    • Oryctes rhinoceros (Coconut rhinoceros beetle)

    • Family

    • Belongs to the coleoptericin family

    • Gene

    • Not found

    • Sequence

    • SLQPGAPNFPMPGSQLPTSITSNIEKQGPNTAATINAQHKTDRYDVGATWSKVIRGPGRSKPNWSIGGTYRW

    • Sequence Length

    • 72

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus (MIC=1 µg/ml), Streptococcus pyogenes (MIC=1 µg/ml);
      • Gram-negative bacterium: Escherichia coli (MIC=1 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02777 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02777.

Physicochemical Information

    • Formula

    • C344H534N102O104S

    • Absent Amino Acids

    • C

    • Common Amino Acids

    • GPST

    • Mass

    • 7794.7

    • PI

    • 10.28

    • Basic Residues

    • 9

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +6

    • Boman Index

    • -136.81

    • Hydrophobicity

    • -0.811

    • Aliphatic Index

    • 52.92

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 19480

    • Absorbance 280nm

    • 274.37

    • Polar Residues

    • 29

DRAMP02777

DRAMP02777 chydropathy plot

Comments Information

    • Function

    • Has strong antibacterial activity against Escherichia coli, Streptococcus pyogenes, Staphylococcus aureus but not against Pseudomonas aeruginosa.

Literature Information

  • ·Literature 1

    • Title

    • Isolation, cDNA cloning and gene expression of an antibacterial protein from larvae of the coconut rhinoceros beetle, Oryctes rhinoceros.

    • Reference

    • Eur J Biochem. 1998 Aug 1;255(3):734-738.

    • Author

    • Yang J, Yamamoto M, Ishibashi J, Taniai K, Yamakawa M.