General Information

    • DRAMP ID

    • DRAMP02788

    • Peptide Name

    • Acaloleptin-A5 (chain of Acaloleptin A; Insects, animals)

    • Source

    • Acalolepta luxuriosa (Udo longhorn beetle)

    • Family

    • Belongs to the coleoptericin family

    • Gene

    • Not found

    • Sequence

    • SDDEDEEEEEDQPWQLNPNIARGDDGNTRADVNIKRRGENHDFEAGWSKVVDGPDRAKPTWHVGGTFRW

    • Sequence Length

    • 69

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Aeromonas hydrophila, Erwinia persicinus, Serratia marcescens, Aeromonas hydrophila.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02788 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02788.

Physicochemical Information

    • Formula

    • C340H503N105O118

    • Absent Amino Acids

    • CMY

    • Common Amino Acids

    • D

    • Mass

    • 7949.37

    • PI

    • 4.44

    • Basic Residues

    • 11

    • Acidic Residues

    • 18

    • Hydrophobic Residues

    • 17

    • Net Charge

    • -7

    • Boman Index

    • -255.94

    • Hydrophobicity

    • -1.546

    • Aliphatic Index

    • 39.57

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 22000

    • Absorbance 280nm

    • 323.53

    • Polar Residues

    • 17

DRAMP02788

DRAMP02788 chydropathy plot

Comments Information

    • Function

    • Acaloleptin A5 shows antibacterial activity against Gram-positive bacteria but not against Gram-negative bacteria, and may also have antifungal activity.

    • Induction

    • By bacterial infection. Expression detected 2 hours post-injection, with expression increasing until 48 hours post-injection and remaining considerably high at least until 72 hours post-injection.

Literature Information

  • ·Literature 1

    • Title

    • Acaloleptins A: inducible antibacterial peptides from larvae of the beetle, Acalolepta luxuriosa.

    • Reference

    • Arch Insect Biochem Physiol. 1999;40(2):88-98.

    • Author

    • Imamura M, Wada S, Koizumi N, Kadotani T, Yaoi K, Sato R, Iwahana H.
  • ·Literature 2

    • Title

    • Multipeptide precursor structure of acaloleptin A isoforms, antibacterial peptides from the Udo longicorn beetle, Acalolepta luxuriosa.

    • Reference

    • Dev Comp Immunol. 2009 Oct;33(10):1120-1127.

    • Author

    • Imamura M, Wada S, Ueda K, Saito A, Koizumi N, Iwahana H, Sato R.