General Information

    • DRAMP ID

    • DRAMP02792

    • Peptide Name

    • Scarabaecin, major form (Insects, animals)

    • Source

    • Oryctes rhinoceros (Coconut rhinoceros beetle)

    • Family

    • Not found

    • Gene

    • scar

    • Sequence

    • ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS

    • Sequence Length

    • 36

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

      • Fungi: P. oryzae (IC50=16 µM), R. solani (IC50=32 µM), Botrytis cinerea (IC50=4 µM), S.tritici (IC50=16 µM), P. syringae pv.mori S6804 (IC50=25 µM); And Staphylococcus aureus, B. bassiana (weak activity).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • The solution structure consists of a two-stranded antiparallel beta-sheet connected by a type-I beta-turn after a short helical turn. All secondary structures and a conserved disulfide bond are located in the C-terminal half of the peptide, residues 18-36. Overall folding is stabilized by a combination of a disulfide bond, seven hydrogen bonds, and numerous hydrophobic interactions.(Ref.2)

    • Helical Wheel Diagram

    • DRAMP02792 helical wheel diagram

    • PDB ID

    • 1IYC resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP02792.

Physicochemical Information

    • Formula

    • C184H288N50O51S2

    • Absent Amino Acids

    • HMQTY

    • Common Amino Acids

    • K

    • Mass

    • 4080.74

    • PI

    • 9.25

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -72.16

    • Hydrophobicity

    • -0.592

    • Aliphatic Index

    • 62.22

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5625

    • Absorbance 280nm

    • 160.71

    • Polar Residues

    • 10

DRAMP02792

DRAMP02792 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Scarabaecin, a novel cysteine-containing antifungal peptide from the rhinoceros beetle, Oryctes rhinoceros.

    • Reference

    • Biochem Biophys Res Commun. 2003 Jul 25;307(2):261-266.

    • Author

    • Tomie T, Ishibashi J, Furukawa S, Kobayashi S, Sawahata R, Asaoka A, Tagawa M, Yamakawa M.
  • ·Literature 2

    • Title

    • Structural basis for new pattern of conserved amino acid residues related to chitin-binding in the antifungal peptide from the coconut rhinoceros beetle Oryctes rhinoceros.

    • Reference

    • J Biol Chem. 2003 Jun 20;278(25):22820-22827.

    • Author

    • Hemmi H, Ishibashi J, Tomie T, Yamakawa M.