General Information

    • DRAMP ID

    • DRAMP02793

    • Peptide Name

    • Antibacterial protein1 (Gonococcal growth inhibitor I)

    • Source

    • Staphylococcus haemolyticus

    • Family

    • Belongs to the staphylococcal hemolytic protein family

    • Gene

    • Not found

    • Sequence

    • MQKLAEAIAAAVSAGQDKDWGKMGTSIVGIVENGITVLGKIFGF

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Gonococci

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02793 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02793.

Physicochemical Information

    • Formula

    • C203H330N52O60S2

    • Absent Amino Acids

    • CHPRY

    • Common Amino Acids

    • G

    • Mass

    • 4523.29

    • PI

    • 5.97

    • Basic Residues

    • 4

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 20

    • Net Charge

    • 0

    • Boman Index

    • -1.89

    • Hydrophobicity

    • 0.461

    • Aliphatic Index

    • 102.05

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 127.91

    • Polar Residues

    • 12

DRAMP02793

DRAMP02793 chydropathy plot

Comments Information

    • Function

    • Has haemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • The amino acid sequence of a gonococcal growth inhibitor from Staphylococcus haemolyticus.

    • Reference

    • Biochem J. 1988 May 15;252(1):87-93.

    • Author

    • Watson DC, Yaguchi M, Bisaillon JG, Beaudet R, Morosoli R.