General Information

    • DRAMP ID

    • DRAMP02799

    • Peptide Name

    • Antimicrobial peptide eNAP-1 (houses, mammals, animals)

    • Source

    • Equus caballus (Horse)

    • Family

    • Belongs to the granulin family

    • Gene

    • Not found

    • Sequence

    • DVQCGEGHFCHDQTCCRASQGGACCPYSQGVCCADQRHCCPVGF

    • Sequence Length

    • 44

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Streptococcus zooepidemicus, Escherichia coli, Pseudomonas aeruginosa, Klebsiella pneumoniae

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02799 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02799.

Physicochemical Information

    • Formula

    • C185H277N61O62S10

    • Absent Amino Acids

    • IKLMNW

    • Common Amino Acids

    • C

    • Mass

    • 4668.21

    • PI

    • 5.74

    • Basic Residues

    • 5

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +1

    • Boman Index

    • -72.05

    • Hydrophobicity

    • -0.243

    • Aliphatic Index

    • 26.59

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 2115

    • Absorbance 280nm

    • 49.19

    • Polar Residues

    • 20

DRAMP02799

DRAMP02799 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity against Gram-negative and Gram-positive bacteria.

    • PTM

    • Contains two disulfide bonds 4-16; 10-26.

Literature Information

  • ·Literature 1

    • Title

    • Identification of eNAP-1, an antimicrobial peptide from equine neutrophils.

    • Reference

    • Infect Immun. 1992 Aug;60(8):3065-3071.

    • Author

    • Couto MA, Harwig SS, Cullor JS, Hughes JP, Lehrer RI.