General Information

    • DRAMP ID

    • DRAMP02807

    • Peptide Name

    • Mytimycin (molluscas, animals)

    • Source

    • Mytilus edulis (Blue mussel)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • DCCRKPFRKHCWDCTAGTPYYGYSTRNIFGCTC

    • Sequence Length

    • 33

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Neurospora crassa, Fusarium culmorum.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02807 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02807.

Physicochemical Information

    • Formula

    • C166H242N48O47S6

    • Absent Amino Acids

    • ELMQV

    • Common Amino Acids

    • C

    • Mass

    • 3854.4

    • PI

    • 8.65

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +4

    • Boman Index

    • -73.18

    • Hydrophobicity

    • -0.633

    • Aliphatic Index

    • 14.85

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 10345

    • Absorbance 280nm

    • 323.28

    • Polar Residues

    • 18

DRAMP02807

DRAMP02807 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Innate immunity. Isolation of several cysteine-rich antimicrobial peptides from the blood of a mollusc, Mytilus edulis.

    • Reference

    • J Biol Chem. 1996 Sep 6;271(36):21808-21813.

    • Author

    • Charlet M, Chernysh S, Philippe H, Hetru C, Hoffmann JA, Bulet P.