General Information

    • DRAMP ID

    • DRAMP02809

    • Peptide Name

    • Myticin-B (Myt B; Cys-rich; molluscas, animals)

    • Source

    • Mytilus galloprovincialis (Mediterranean mussel)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • HPHVCTSYYCSKFCGTAGCTRYGCRNLHRGKLCFCLHCSR

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-positive bacteria: Micrococcus luteus (MBC=1-2 µM), Bacillus megaterium (MBC=1-2 µM), Aerococcus viridans (MBC=2-4 µM).
      • Gram-negative bacteria: Escherichia coli D31 (MBC=20-10 µM).
      • Fungi: Fusarium oxysporum (MIC=5-10 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • contains four disulfide bonds.

    • Stereochemistry

    • L

    • Structure

    • Rich

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02809 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02809.

Physicochemical Information

    • Formula

    • C193H295N63O51S8

    • Absent Amino Acids

    • DEIMQW

    • Common Amino Acids

    • C

    • Mass

    • 4570.34

    • PI

    • 9.1

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +10

    • Boman Index

    • -73.82

    • Hydrophobicity

    • -0.268

    • Aliphatic Index

    • 39

    • Half Life

      • Mammalian:3.5 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 127.44

    • Polar Residues

    • 22

DRAMP02809

DRAMP02809 chydropathy plot

Comments Information

    • Function

    • Bacteriolytic activity against Gram-positive bacteria and Gram-negative bacteria. Also possesses antifungal activity against F. oxysporum.

    • PTM

    • contains four disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Myticin, a novel cysteine-rich antimicrobial peptide isolated from haemocytes and plasma of the mussel Mytilus galloprovincialis.

    • Reference

    • Eur J Biochem. 1999 Oct 1;265(1):71-78.

    • Author

    • Mitta G, Hubert F, Noël T, Roch P.