• • DRAMP ID

  • DRAMP02811

• • Peptide Name

  • Defensin MGD-1 (molluscas, animals)

• • Source

  • Mytilus galloprovincialis (Mediterranean mussel)

• • Family

  • Not found

• • Gene

  • FH3

• • Sequence

  • GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC

• • Sequence Length

  • 38

• • UniProt Entry

  • P80571,Q9Y0B0

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-positive bacteria: Micrococcus luteus (MIC=0.4 µM)&(MBC=1.5 µM), Bacillus megaterium (MIC=0.8 µM)&(MBC=1.5 µM), Staphylococcus aureus (MIC=0.6 µM)&(MBC=1.2 µM), Staphylococcus epidermidis (MIC=3.1 µM)&(MBC=6.2 µM), Enterococcus fecalis (MIC=0.6 µM)&(MBC=1.2 µM), Aerococcus viridans (MIC=0.4 µM)&(MBC=1.5 µM);
    • Gram-negative bacteria: Escherichia coli D31 (MIC=1.2 µM)&(MBC=1.2 µM), E. coli 363 (MIC=1.2 µM)&(MBC=1.2 µM), Salmonella newport (MIC>100 µM)&(MBC>100 µM), Vibrio alginolyticus (MIC=50 µM)&(MBC>100 µM), Vibrio harveyi (MIC=50 µM)&(MBC=100 µM), Vibrio metshnikovii (MIC>100 µM)&(MBC>100 µM).
    • NOTE: MIC=minimal inhibitory concentration; MBC = minimal bactericidal concentration.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bond between Cys4 and Cys25, Cys10 and Cys33, Cys14 and Cys35,Cys21 and Cys38.

• • Stereochemistry

  • L

• • Structure

  • Combine helix and strand structure

• • Structure Description

  • The three-dimensional solution structure of MGD-1 has been established using (1)H NMR and mainly consists of a helical part (Asn7-Ser16) and two antiparallel beta-strands (Arg20-Cys25 and Cys33-Arg37), together giving rise to the common cystine-stabilized alpha-beta motif frequently observed in scorpion toxins. In MGD-1, the cystine-stabilized alpha-beta motif is stabilized by four disulfide bonds (Cys4-Cys25, Cys10-Cys33, Cys14-Cys35,

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 1FJN resolved by NMR.
• 1FJN-> 

• Predicted Structure

• Please click DRAMP02811_predicted_structure.pdb to download.

DRAMP02811

• • Function

  • Active against both Gram-positive and Gram-negative bacteria but is not cytotoxic towards human erythrocytes or protozoa.

• • Transgenic plants

  • expression of this peptide in tobacco improves resistance to pathogens.

• • PTM

  • Contains four disulfide bonds 4-25; 10-33; 14-35; 21-38.

• ·Literature 1

• • Title

  • Mussel defensins are synthesised and processed in granulocytes then released into the plasma after bacterial challenge.

• • Pubmed ID

  • 10564642

• • Reference

  • J. Cell Sci. 1999;112:4233-4242.

• • Author

  • Mitta G, Vandenbulcke F, Hubert F, Roch P.

• ·Literature 2

• • Title

  • A member of the arthropod defensin family from edible Mediterranean mussels (Mytilus galloprovincialis).

• • Pubmed ID

  • 8925841

• • Reference

  • Eur. J. Biochem. 1996;240:302-306.

• • Author

  • Hubert F, Noeel T, Roch P.

• ·Literature 3

• • Title

  • Solution structure and activity of the synthetic four-disulfide bond Mediterranean mussel defensin (MGD-1).

• • Pubmed ID

  • 11087396

• • Reference

  • Biochemistry 2000 Nov 28;39(47):14436-47.

• • Author

  • Yang YS, Mitta G, Chavanieu A, Calas B, Sanchez JF, Roch P, Aumelas A.