• DRAMP ID

    • DRAMP02811
    • Peptide Name

    • Defensin MGD-1 (molluscas, animals)
    • Source

    • Mytilus galloprovincialis (Mediterranean mussel)
    • Family

    • Not found
    • Gene

    • FH3
    • Sequence

    • GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
    • Sequence Length

    • 38
    • Protein Existence

    • Protein level
    • SMILES

    • CC[C@@H](C)[C@@H]1NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]2CSSC[C@@H]3NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H]4CSSC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](Cc5ccc(O)cc5)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H]5CCCN5C(=O)[C@@H](NC(=O)CNC(=O)[C@H](Cc5ccccc5)NC(=O)CN)CSSC[C@H](NC(=O)[C@H](Cc5ccc(O)cc5)NC(=O)CNC(=O)CNC(=O)[C@H](CSSC[C@@H](C(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc5ccc(O)cc5)NC3=O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC(=O)[C@@H]3CCCN3C1=O)C(=O)NCC(=O)NCC(=O)N[C@@H](Cc1c[nH]c3ccccc13)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N4)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N2
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Micrococcus luteus (MIC=0.4 µM)&MBC=1.5 µM
        Bacillus megaterium (MIC=0.8 µM)&MBC=1.5 µM
        Staphylococcus aureus (MIC=0.6 µM)&MBC=1.2 µM
        Staphylococcus epidermidis (MIC=3.1 µM)&MBC=6.2 µM
        Enterococcus fecalis (MIC=0.6 µM)&MBC=1.2 µM
        Aerococcus viridans (MIC=0.4 µM)&(MBC=1.5 µM);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli D31 (MIC=1.2 µM)&MBC=1.2 µM
        E. coli 363 (MIC=1.2 µM)&MBC=1.2 µM
        Salmonella newport (MIC>100 µM)&MBC>100 µM
        Vibrio alginolyticus (MIC=50 µM)&MBC>100 µM
        Vibrio harveyi (MIC=50 µM)&MBC=100 µM
        Vibrio metshnikovii (MIC>100 µM)&MBC>100 µM
      • NOTE:
        Target OrganismActivity
        MIC=minimal inhibitory concentration; MBC = minimal bactericidal concentration-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys4 and Cys25, Cys10 and Cys33, Cys14 and Cys35,Cys21 and Cys38.
    • Stereochemistry

    • L
    • PDB ID

    • 1FJN resolved by NMR.
    • Predicted Structure

    • Formula

    • C181H270N64O47S8
    • Absent Amino Acids

    • ADEMV
    • Common Amino Acids

    • C
    • Mass

    • 4351.02
    • PI

    • 9.12
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 4
    • Net Charge

    • +9
    • Boman Index

    • -87.37
    • Hydrophobicity

    • -0.729
    • Aliphatic Index

    • 20.53
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10470
    • Absorbance 280nm

    • 282.97
    • Polar Residues

    • 22

DRAMP02811

    • Function

    • Active against both Gram-positive and Gram-negative bacteria but is not cytotoxic towards human erythrocytes or protozoa.
    • Transgenic plants

    • expression of this peptide in tobacco improves resistance to pathogens.
    • PTM

    • Contains four disulfide bonds 4-25; 10-33; 14-35; 21-38.
  • ·Literature 1
    • Title

    • Mussel defensins are synthesised and processed in granulocytes then released into the plasma after bacterial challenge.
    • Reference

    • J. Cell Sci. 1999;112:4233-4242.
    • Author

    • Mitta G, Vandenbulcke F, Hubert F, Roch P.
  • ·Literature 2
    • Title

    • A member of the arthropod defensin family from edible Mediterranean mussels (Mytilus galloprovincialis).
    • Reference

    • Eur. J. Biochem. 1996;240:302-306.
    • Author

    • Hubert F, Noeel T, Roch P.
  • ·Literature 3
    • Title

    • Solution structure and activity of the synthetic four-disulfide bond Mediterranean mussel defensin (MGD-1).
    • Reference

    • Biochemistry 2000 Nov 28;39(47):14436-47.
    • Author

    • Yang YS, Mitta G, Chavanieu A, Calas B, Sanchez JF, Roch P, Aumelas A.