General Information

    • DRAMP ID

    • DRAMP02824

    • Peptide Name

    • Lingual antimicrobial peptide (mammals, animals)

    • Source

    • Bubalus bubalis (Domestic water buffalo)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antiviral

    • Target Organism

    • Escherichia coli, Staphylococcus aureus, Streptococcus pyogenes, Candida albicans, Rinderpest Virus (RPV) and Newcastle Disease Virus (NDV)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02824 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02824.

Physicochemical Information

    • Formula

    • C179H321N69O50S7

    • Absent Amino Acids

    • DEFHWY

    • Common Amino Acids

    • R

    • Mass

    • 4464.37

    • PI

    • 10.85

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +10

    • Boman Index

    • -116.36

    • Hydrophobicity

    • -0.5

    • Aliphatic Index

    • 63.25

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 9.62

    • Polar Residues

    • 16

DRAMP02824

DRAMP02824 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity (By similarity).

    • PTM

    • Contains three disulfide bonds 7-36; 14-29; 19-37.

Literature Information

  • ·Literature 1

    • Title

    • Beta-defensin antibiotic peptides in the innate immunity of the buffalo: in vivo and in vitro studies.

    • Reference

    • Altern Lab Anim. 2008 Sep;36(4):429-440.

    • Author

    • Das H, Swamy N, Sahoo G, Ahmed S.U, More T.