General Information

    • DRAMP ID

    • DRAMP02829

    • Peptide Name

    • Seminalplasmin

    • Source

    • Bos taurus (Bovine)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • SDEKASPDKHHRFSLSRYAKLANRLANPKLLETFLSKWIGDRGNRSV

    • Sequence Length

    • 47

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02829 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02829.

Physicochemical Information

    • Formula

    • C239H383N75O69

    • Absent Amino Acids

    • CMQ

    • Common Amino Acids

    • LS

    • Mass

    • 5411.13

    • PI

    • 10.27

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +7

    • Boman Index

    • -138.59

    • Hydrophobicity

    • -0.932

    • Aliphatic Index

    • 72.77

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 151.96

    • Polar Residues

    • 13

DRAMP02829

DRAMP02829 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Amino acid sequence of seminalplasmin, an antimicrobial protein from bull semen.

    • Reference

    • EMBO J. 1983;2(7):1159-1163.

    • Author

    • Theil R, Scheit KH.