• DRAMP ID

    • DRAMP02830
    • Peptide Name

    • Chrombacin
    • Source

    • Bos taurus (Bovine)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQR
    • Sequence Length

    • 60
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02830 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02830.
    • Formula

    • C302H470N82O109S2
    • Absent Amino Acids

    • CW
    • Common Amino Acids

    • E
    • Mass

    • 7057.66
    • PI

    • 4.29
    • Basic Residues

    • 9
    • Acidic Residues

    • 19
    • Hydrophobic Residues

    • 17
    • Net Charge

    • -10
    • Boman Index

    • -201.06
    • Hydrophobicity

    • -1.307
    • Aliphatic Index

    • 55.5
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1490
    • Absorbance 280nm

    • 25.25
    • Polar Residues

    • 6

DRAMP02830

DRAMP02830 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A sulfated, phosphorylated 7 kDa secreted peptide characterized by direct analysis of cell culture media.
    • Reference

    • J Proteome Res. 2008 Feb;7(2):795-802.
    • Author

    • Taylor SW, Sun C, Hsieh A, Andon NL, Ghosh SS.