General Information

    • DRAMP ID

    • DRAMP02830

    • Peptide Name

    • Chrombacin

    • Source

    • Bos taurus (Bovine)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQR

    • Sequence Length

    • 60

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02830 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02830.

Physicochemical Information

    • Formula

    • C302H470N82O109S2

    • Absent Amino Acids

    • CW

    • Common Amino Acids

    • E

    • Mass

    • 7057.66

    • PI

    • 4.29

    • Basic Residues

    • 9

    • Acidic Residues

    • 19

    • Hydrophobic Residues

    • 17

    • Net Charge

    • -10

    • Boman Index

    • -201.06

    • Hydrophobicity

    • -1.307

    • Aliphatic Index

    • 55.5

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1490

    • Absorbance 280nm

    • 25.25

    • Polar Residues

    • 6

DRAMP02830

DRAMP02830 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A sulfated, phosphorylated 7 kDa secreted peptide characterized by direct analysis of cell culture media.

    • Reference

    • J Proteome Res. 2008 Feb;7(2):795-802.

    • Author

    • Taylor SW, Sun C, Hsieh A, Andon NL, Ghosh SS.