• DRAMP ID

    • DRAMP02831
    • Peptide Name

    • Protein S100-A8 (Calgranulin-A; MRP-8; mammals, animals)
    • Source

    • Bos taurus (Bovine)
    • Family

    • Belongs to the S-100 family
    • Gene

    • S100A8
    • Sequence

    • MLTDLECAINSLIDVYHKYSLKKGNYHAVYRDDLKQLLETECPKFMKKKDADTWFKELDINQDGGINFEEFLVLVIKVGLEAHEEIHKE
    • Sequence Length

    • 89
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Metal-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C473H736N118O141S4
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • KLE
    • Mass

    • 10459.99
    • PI

    • 5.11
    • Basic Residues

    • 16
    • Acidic Residues

    • 18
    • Hydrophobic Residues

    • 31
    • Net Charge

    • -2
    • Boman Index

    • -148.83
    • Hydrophobicity

    • -0.452
    • Aliphatic Index

    • 95.28
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11585
    • Absorbance 280nm

    • 131.65
    • Polar Residues

    • 19

DRAMP02831

    • Function

    • Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect.
    • Tissue specificity

    • Found essentially in phagocytic cells.
    • Miscellaneous

    • Binds two calcium ions per molecule with an affinity similar to that of the S100 proteins (By similarity).
  • ·Literature 1
    • Title

    • The 23-kilodalton protein, a substrate of protein kinase C, in bovine neutrophil cytosol is a member of the S100 family.
    • Reference

    • Biochemistry. 1992 Jun 30;31(25):5898-5905.
    • Author

    • Dianoux AC, Stasia MJ, Garin J, Gagnon J, Vignais PV.
  • ·Literature 2
    • Title

    • Nuclear proteins of the bovine esophageal epithelium. I. Monoclonal antibody W2 specifically reacts with condensed nuclei of differentiated superficial cells.
    • Reference

    • J Cell Sci. 1993 Feb;104 ( Pt 2):237-247.
    • Author

    • Tang TK, Hong TM, Lin CY, Lai ML, Liu CH, Lo HJ, Wang ME, Chen LB, Chen WT, Ip W, et al.