General Information

    • DRAMP ID

    • DRAMP02833

    • Peptide Name

    • Glycolactin (Antiviral defensin; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the pancreatic ribonuclease family

    • Gene

    • Not found

    • Sequence

    • SALYALYDFSPPARKMRAYTVRAYVHGSYSRRGPWYDFEPVPGASMDGL

    • Sequence Length

    • 49

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02833 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02833.

Physicochemical Information

    • Formula

    • C255H372N68O70S2

    • Absent Amino Acids

    • CINQ

    • Common Amino Acids

    • AY

    • Mass

    • 5574.29

    • PI

    • 9.22

    • Basic Residues

    • 7

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +3

    • Boman Index

    • -83.7

    • Hydrophobicity

    • -0.457

    • Aliphatic Index

    • 53.88

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14440

    • Absorbance 280nm

    • 300.83

    • Polar Residues

    • 16

DRAMP02833

DRAMP02833 chydropathy plot

Comments Information

    • Function

    • MManifests poly C-specific RNase activity toward yeast tRNA, elicits a dose-dependent inhibition of cell-free translation, inhibits formation of superoxide ions in vitro and inhibits the hemagglutinating activities of soybean lectin and Ricinus communis agglutinin 120. Inhibits HIV-1 reverse transcriptase.

    • Tissue specificity

    • Milk.

Literature Information

  • ·Literature 1

    • Title

    • Isolation and characterization of angiogenin-1 and a novel protein designated lactogenin from bovine milk.

    • Reference

    • Biochem Biophys Res Commun. 1999 Sep 16;263(1):187-191.

    • Author

    • Ye XY, Cheng KJ, Ng TB.
  • ·Literature 2

    • Title

    • First demonstration of an inhibitory activity of milk proteins against human immunodeficiency virus-1 reverse transcriptase and the effect of succinylation.

    • Reference

    • Life Sci. 2000 Oct 20;67(22):2745-2752.

    • Author

    • Wang H, Ye X, Ng TB.