General Information

    • DRAMP ID

    • DRAMP02837

    • Peptide Name

    • Beta-defensin C7 (BBD(C7); mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • PLSCRRKGGICILIRCPGPMRQIGTCFGRPVKCCR

    • Sequence Length

    • 35

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02837 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02837.

Physicochemical Information

    • Formula

    • C163H284N56O39S7

    • Absent Amino Acids

    • ADEHNWY

    • Common Amino Acids

    • CR

    • Mass

    • 3876.82

    • PI

    • 10.22

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +8

    • Boman Index

    • -60.86

    • Hydrophobicity

    • 0.037

    • Aliphatic Index

    • 75.14

    • Half Life

      • Mammalian:>20 hour
      • Yeast:>20 hour
      • E.coli:?

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 11.03

    • Polar Residues

    • 13

DRAMP02837

DRAMP02837 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.

    • Reference

    • Infect Immun. 1998 Mar;66(3):1045-1056.

    • Author

    • Tarver AP, Clark DP, Diamond G, Russell JP, Erdjument-Bromage H, Tempst P, Cohen KS, Jones DE, Sweeney RW, Wines M, Hwang S, Bevins CL.