General Information

    • DRAMP ID

    • DRAMP02839

    • Peptide Name

    • Enteric Beta-defensin (mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family (LAP/TAP subfamily)

    • Gene

    • EBD

    • Sequence

    • NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR

    • Sequence Length

    • 38

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02839 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02839.

Physicochemical Information

    • Formula

    • C183H306N62O47S6

    • Absent Amino Acids

    • ADEHMY

    • Common Amino Acids

    • CR

    • Mass

    • 4319.19

    • PI

    • 9.99

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +7

    • Boman Index

    • -79.06

    • Hydrophobicity

    • -0.14

    • Aliphatic Index

    • 76.84

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 158.78

    • Polar Residues

    • 16

DRAMP02839

DRAMP02839 chydropathy plot

Comments Information

    • Tissue specificity

    • Inducibly expressed in enteric epithelial cells.

    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35.

Literature Information

  • ·Literature 1

    • Title

    • Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.

    • Reference

    • Infect Immun. 1998 Mar;66(3):1045-1056.

    • Author

    • Tarver AP, Clark DP, Diamond G, Russell JP, Erdjument-Bromage H, Tempst P, Cohen KS, Jones DE, Sweeney RW, Wines M, Hwang S, Bevins CL.
  • ·Literature 2

    • Title

    • Somatic cell mapping of beta-defensin genes to cattle syntenic group U25 and fluorescence in situ localization to chromosome 27.

    • Reference

    • Mamm Genome. 1995 Aug;6(8):554-556.

    • Author

    • Gallagher DS Jr, Ryan AM, Diamond G, Bevins CL, Womack JE.