• DRAMP ID

    • DRAMP02839
    • Peptide Name

    • Enteric Beta-defensin (mammals, animals)
    • Source

    • Bos taurus (Bovine)
    • Family

    • Belongs to the beta-defensin family (LAP/TAP subfamily)
    • Gene

    • EBD
    • Sequence

    • NPLSCRLNRGICVPIRCPGNLRQIGTCFTPSVKCCRWR
    • Sequence Length

    • 38
    • Protein Existence

    • Transcript level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C183H306N62O47S6
    • Absent Amino Acids

    • ADEHMY
    • Common Amino Acids

    • CR
    • Mass

    • 4319.19
    • PI

    • 9.99
    • Basic Residues

    • 7
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +7
    • Boman Index

    • -79.06
    • Hydrophobicity

    • -0.14
    • Aliphatic Index

    • 76.84
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 158.78
    • Polar Residues

    • 16

DRAMP02839

DRAMP02839 chydropathy plot
    • Tissue specificity

    • Inducibly expressed in enteric epithelial cells.
    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35.
  • ·Literature 1
    • Title

    • Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.
    • Reference

    • Infect Immun. 1998 Mar;66(3):1045-1056.
    • Author

    • Tarver AP, Clark DP, Diamond G, Russell JP, Erdjument-Bromage H, Tempst P, Cohen KS, Jones DE, Sweeney RW, Wines M, Hwang S, Bevins CL.
  • ·Literature 2
    • Title

    • Somatic cell mapping of beta-defensin genes to cattle syntenic group U25 and fluorescence in situ localization to chromosome 27.
    • Reference

    • Mamm Genome. 1995 Aug;6(8):554-556.
    • Author

    • Gallagher DS Jr, Ryan AM, Diamond G, Bevins CL, Womack JE.