General Information

    • DRAMP ID

    • DRAMP02848

    • Peptide Name

    • Apolipoprotein A-II(1-76)(mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the apolipoprotein A2 family

    • Gene

    • APOA2

    • Sequence

    • QAEESNLQSLVSQYFQTVADYGKDLVEKAKGSELQTQAKAYFEKTQEELTPFFKKAGTDLLNFLSSFIDPKKQPAT

    • Sequence Length

    • 76

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • Escherichia coli and yeasts.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02848 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02848.

Physicochemical Information

    • Formula

    • C387H599N95O124

    • Absent Amino Acids

    • CHMRW

    • Common Amino Acids

    • KLQ

    • Mass

    • 8566.58

    • PI

    • 4.99

    • Basic Residues

    • 9

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 25

    • Net Charge

    • -2

    • Boman Index

    • -136.57

    • Hydrophobicity

    • -0.666

    • Aliphatic Index

    • 66.84

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4470

    • Absorbance 280nm

    • 59.6

    • Polar Residues

    • 20

DRAMP02848

DRAMP02848 chydropathy plot

Comments Information

    • Function

    • May stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Has antimicrobial activity.

Literature Information

  • ·Literature 1

    • Title

    • Purification, primary structure, and antimicrobial activities of bovine apolipoprotein A-II.

    • Reference

    • J Biochem. 1998 Apr;123(4):675-679.

    • Author

    • Motizuki M, Itoh T, Yamada M, Shimamura S, Tsurugi K.