General Information

    • DRAMP ID

    • DRAMP02858

    • Peptide Name

    • Bovine Beta-defensin 1 (bBD-1; BNBD-1; BNDB-1; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB1

    • Sequence

    • DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02858 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02858.

Physicochemical Information

    • Formula

    • C182H287N59O47S7

    • Absent Amino Acids

    • EY

    • Common Amino Acids

    • C

    • Mass

    • 4278.07

    • PI

    • 8.98

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -58.93

    • Hydrophobicity

    • -0.042

    • Aliphatic Index

    • 61.58

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 158.78

    • Polar Residues

    • 15

DRAMP02858

DRAMP02858 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity. Active against E. coli ML35 but not against S. aureus 502A.

    • Tissue specificity

    • Neutrophilic granules.

    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35. (By similarity)

Literature Information

  • ·Literature 1

    • Title

    • Molecular and functional characterization of bovine beta-defensin-1.

    • Reference

    • Vet Immunol Immunopathol. 2006 Sep 15;113(1-2):181-190.

    • Author

    • Aono S, Li C, Zhang G, Kemppainen RJ, Gard J, Lu W, Hu X, Schwartz DD, Morrison EE, Dykstra C, Shi J.