• DRAMP ID

    • DRAMP02858
    • Peptide Name

    • Bovine Beta-defensin 1 (bBD-1; BNBD-1; BNDB-1; mammals, animals)
    • Source

    • Bos taurus (Bovine)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB1
    • Sequence

    • DFASCHTNGGICLPNRCPGHMIQIGICFRPRVKCCRSW
    • Sequence Length

    • 38
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-
    • Target Organism

      • Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02858 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02858.
    • Formula

    • C182H287N59O47S7
    • Absent Amino Acids

    • EY
    • Common Amino Acids

    • C
    • Mass

    • 4278.07
    • PI

    • 8.98
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +6
    • Boman Index

    • -58.93
    • Hydrophobicity

    • -0.042
    • Aliphatic Index

    • 61.58
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 158.78
    • Polar Residues

    • 15

DRAMP02858

DRAMP02858 chydropathy plot
    • Function

    • Has bactericidal activity. Active against E. coli ML35 but not against S. aureus 502A.
    • Tissue specificity

    • Neutrophilic granules.
    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35. (By similarity)
  • ·Literature 1
    • Title

    • Molecular and functional characterization of bovine beta-defensin-1.
    • Reference

    • Vet Immunol Immunopathol. 2006 Sep 15;113(1-2):181-190.
    • Author

    • Aono S, Li C, Zhang G, Kemppainen RJ, Gard J, Lu W, Hu X, Schwartz DD, Morrison EE, Dykstra C, Shi J.