General Information

    • DRAMP ID

    • DRAMP02864

    • Peptide Name

    • Bovine Beta-defensin 7 (bBD-7; BNBD-7; BNDB-7; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB7

    • Sequence

    • QGVRNFVTCRINRGFCVPIRCPGHRRQIGTCLGPRIKCCR

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus 502A;
      • Gram-negative bacterium: Escherichia coli ML35

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02864 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02864.

Physicochemical Information

    • Formula

    • C192H325N71O47S6

    • Absent Amino Acids

    • ADEMSWY

    • Common Amino Acids

    • R

    • Mass

    • 4572.5

    • PI

    • 11.2

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +10

    • Boman Index

    • -104.01

    • Hydrophobicity

    • -0.258

    • Aliphatic Index

    • 70.5

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 9.62

    • Polar Residues

    • 15

DRAMP02864

DRAMP02864 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity. Active against E. coli ML35 and S. aureus 502A.

    • Tissue specificity

    • Neutrophilic granules.

    • PTM

    • Contains three disulfide bonds 9-38; 16-31; 21-39. (By similarity)

Literature Information

  • ·Literature 1

    • Title

    • Purification, primary structures, and antibacterial activities of Beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.

    • Reference

    • J Biol Chem. 1993 Mar 25;268(9):6641-6648.

    • Author

    • Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.