General Information

    • DRAMP ID

    • DRAMP02868

    • Peptide Name

    • Bovine Beta-defensin 11 (bBD-11; BNBD-11; BNDB-11; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB11

    • Sequence

    • GPLSCRRNGGVCIPIRCPGPMRQIGTCFGRPVKCCRSW

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus 502A (MIC=10-300 µg/ml);
      • Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02868 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02868.

Physicochemical Information

    • Formula

    • C175H290N60O44S7

    • Absent Amino Acids

    • ADEHY

    • Common Amino Acids

    • CGR

    • Mass

    • 4163.02

    • PI

    • 9.99

    • Basic Residues

    • 7

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -67.88

    • Hydrophobicity

    • -0.161

    • Aliphatic Index

    • 56.32

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 158.78

    • Polar Residues

    • 16

DRAMP02868

DRAMP02868 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity. Active against E. coli ML35 and S. aureus 502A.

    • Tissue specificity

    • Neutrophilic granules.

    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35. (By similarity)

Literature Information

  • ·Literature 1

    • Title

    • Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.

    • Reference

    • J Biol Chem. 1993 Mar 25;268(9):6641-6648.

    • Author

    • Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.
  • ·Literature 2

    • Title

    • Bovine beta-defensins: identification and characterization of novel bovine beta-defensin genes and their expression in mammary gland tissue.

    • Reference

    • Mamm Genome. 2004 Oct;15(10):834-842.

    • Author

    • Roosen S, Exner K, Paul S, Schröder JM, Kalm E, Looft C.