General Information

    • DRAMP ID

    • DRAMP02875

    • Peptide Name

    • Vasostatin-1 (VS-1; N-terminal fragment of Chromogranin-A; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the chromogranin/secretogranin protein family

    • Gene

    • CHGA

    • Sequence

    • LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETLRGDERILSILRHQNLLKELQDLALQGAKERTHQQ

    • Sequence Length

    • 76

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • Gram-positive bacteria: Micrococcus luteus (MIC=2 µM), Bacillus megaterium (MIC=0.2 µM).
      • Fungi: Neurospora crassa (MIC=3 µM), Aspergillus fumigatus (MIC=5 µM), Alternaria brassicicola (MIC=3 µM), Nectria haematococca (MIC=1 µM), Fusarium culmorum (MIC=1 µM), F. oxyporum (MIC=10 µM), Saccharomyces cerevisiae (MIC=10 µM), Candida albicans (MIC=10 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Binds calcium with a low-affinity.

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02875 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP02875.

Physicochemical Information

    • Formula

    • C370H620N106O117S5

    • Absent Amino Acids

    • WY

    • Common Amino Acids

    • L

    • Mass

    • 8585.93

    • PI

    • 6.11

    • Basic Residues

    • 12

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +1

    • Boman Index

    • -155.04

    • Hydrophobicity

    • -0.487

    • Aliphatic Index

    • 93.55

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 1.67

    • Polar Residues

    • 18

DRAMP02875

DRAMP02875 chydropathy plot

Comments Information

    • Function

    • Vasostatin-1 has antibacterial activity against Gram-positive bacteria M. luteus, B. megaterium. Possesses antifungal activity against N. crassa, A. fumigatus, A. brassicicola, N. hematococca, F. culmorum and F. oxyporum and against the yeast S. cerevisiae and C. albicans.

    • Miscellaneous

    • Binds calcium with a low-affinity.

Literature Information

  • ·Literature 1

    • Title

    • Antibacterial and antifungal activities of vasostatin-1, the N-terminal fragment of chromogranin A.

    • Reference

    • J Biol Chem. 2000 Apr 14;275(15):10745-10753.

    • Author

    • Lugardon K, Raffner R, Goumon Y, Corti A, Delmas A, Bulet P, Aunis D, Metz-Boutigue MH.