• DRAMP ID

    • DRAMP02881
    • Peptide Name

    • Antimicrobial protein exons 1-2 (mammals, animals)
    • Source

    • Bos taurus (Bovine)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCR
    • Sequence Length

    • 36
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

      • Yeast: Candida ablicans.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • dulsulfide-bond link
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02881 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02881.
    • Formula

    • C157H278N54O43S7
    • Absent Amino Acids

    • DEFHLWY
    • Common Amino Acids

    • C
    • Mass

    • 3834.69
    • PI

    • 9.7
    • Basic Residues

    • 7
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +7
    • Boman Index

    • -53.96
    • Hydrophobicity

    • 0.119
    • Aliphatic Index

    • 75.56
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 10.71
    • Polar Residues

    • 15

DRAMP02881

DRAMP02881 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Airway epithelial cells are the site of expression of a mammalian antimicrobial peptide gene.
    • Reference

    • Proc Natl Acad Sci U S A. 1993 May 15;90(10):4596-600.
    • Author

    • Diamond G, Jones DE, Bevins CL.