General Information

    • DRAMP ID

    • DRAMP02883

    • Peptide Name

    • Drosomycin-like A (Predicted)

    • Source

    • Drosophila triauraria

    • Family

    • Not found

    • Gene

    • Drsl-B

    • Sequence

    • MIQIKFLCLFLAIMTIVVLDSNVAEARDCLSGTFKGPCWAWSGEKCRRLCIEEGRVSGHCSGGSKCWCEGC

    • Sequence Length

    • 71

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02883 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02883.

Physicochemical Information

    • Formula

    • C338H536N94O96S11

    • Absent Amino Acids

    • Y

    • Common Amino Acids

    • CG

    • Mass

    • 7805.21

    • PI

    • 7.49

    • Basic Residues

    • 9

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 25

    • Net Charge

    • +2

    • Boman Index

    • -58.56

    • Hydrophobicity

    • 0.31

    • Aliphatic Index

    • 82.39

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17000

    • Absorbance 280nm

    • 242.86

    • Polar Residues

    • 26

DRAMP02883

DRAMP02883 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Upregulation of genes belonging to the drosomycin family in diapausing adults of Drosophila triauraria.

    • Reference

    • Gene. 2001 Oct 31;278(1-2):177-184.

    • Author

    • Daibo S, Kimura MT, Goto SG.