• DRAMP ID

    • DRAMP02883
    • Peptide Name

    • Drosomycin-like A (Predicted)
    • Source

    • Drosophila triauraria
    • Family

    • Not found
    • Gene

    • Drsl-B
    • Sequence

    • MIQIKFLCLFLAIMTIVVLDSNVAEARDCLSGTFKGPCWAWSGEKCRRLCIEEGRVSGHCSGGSKCWCEGC
    • Sequence Length

    • 71
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02883 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02883.
    • Formula

    • C338H536N94O96S11
    • Absent Amino Acids

    • Y
    • Common Amino Acids

    • CG
    • Mass

    • 7805.21
    • PI

    • 7.49
    • Basic Residues

    • 9
    • Acidic Residues

    • 7
    • Hydrophobic Residues

    • 25
    • Net Charge

    • +2
    • Boman Index

    • -58.56
    • Hydrophobicity

    • 0.31
    • Aliphatic Index

    • 82.39
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 17000
    • Absorbance 280nm

    • 242.86
    • Polar Residues

    • 26

DRAMP02883

DRAMP02883 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Upregulation of genes belonging to the drosomycin family in diapausing adults of Drosophila triauraria.
    • Reference

    • Gene. 2001 Oct 31;278(1-2):177-184.
    • Author

    • Daibo S, Kimura MT, Goto SG.