• DRAMP ID

    • DRAMP02886
    • Peptide Name

    • Drosomycin-like 5 (Drosomycin-like E; Drosomycin-like G; Predicted)
    • Source

    • Drosophila melanogaster (Fruit fly)
    • Family

    • Not found
    • Gene

    • Drsl5
    • Sequence

    • MQIKFLYLFLAVMTIFILGAKEADADCLSGRYGGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC
    • Sequence Length

    • 69
    • Protein Existence

    • Predicted
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02886 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02886.
    • Formula

    • C332H517N91O97S10
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • CG
    • Mass

    • 7655.91
    • PI

    • 6.52
    • Basic Residues

    • 9
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 22
    • Net Charge

    • +1
    • Boman Index

    • -80.78
    • Hydrophobicity

    • 0.036
    • Aliphatic Index

    • 70.72
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14480
    • Absorbance 280nm

    • 212.94
    • Polar Residues

    • 25

DRAMP02886

DRAMP02886 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Functional divergence of six isoforms of antifungal peptide Drosomycin in Drosophila melanogaster.
    • Reference

    • Gene. 2006 Sep 1;379:26-32.
    • Author

    • Yang WY, Wen SY, Huang YD, Ye MQ, Deng XJ, Han D, Xia QY, Cao Y.