General Information

    • DRAMP ID

    • DRAMP02890

    • Peptide Name

    • Dro6 protein (Drosomycin-like 6; Drosomycin-like D; Drosomycin-like I; Predicted)

    • Source

    • Drosophila melanogaster (Fruit fly)

    • Family

    • Not found

    • Gene

    • Drsl6

    • Sequence

    • MMQIKFLFTFLALLMMVILGAKEADADCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGHCSARLQCWCEGC

    • Sequence Length

    • 72

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02890 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02890.

Physicochemical Information

    • Formula

    • C347H555N105O98S12

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • CRGL

    • Mass

    • 8150.59

    • PI

    • 8.17

    • Basic Residues

    • 11

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +3

    • Boman Index

    • -117.41

    • Hydrophobicity

    • 0.033

    • Aliphatic Index

    • 73.19

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12990

    • Absorbance 280nm

    • 182.96

    • Polar Residues

    • 22

DRAMP02890

DRAMP02890 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Functional divergence of six isoforms of antifungal peptide Drosomycin in Drosophila melanogaster.

    • Reference

    • Gene. 2006 Sep 1;379:26-32.

    • Author

    • Yang WY, Wen SY, Huang YD, Ye MQ, Deng XJ, Han D, Xia QY, Cao Y.